SCOPe 2.06: Domain d5kp3b_: 5kp3 B:

Lineage for d5kp3b_ (5kp3 B:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.4: NTF2-like [54427] (31 families)
   has a beta-alpha(2)-beta insertion after the main helix

5. Family d.17.4.3: Ketosteroid isomerase-like [54434] (3 proteins)
   automatically mapped to Pfam PF12680
   automatically mapped to Pfam PF02136

6. Protein Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI [54435] (2 species)

7. Species Pseudomonas putida [TaxId:303] [54437] (46 PDB entries)
   Uniprot P07445

8. Domain d5kp3b_: 5kp3 B: [322255]
   automated match to d3t8nf_
   complexed with equ, so4

Details for d5kp3b_

PDB Entry: 5kp3, 1.7 Å

PDB Description: crystal structure of ketosteroid isomerase from pseudomonas putida (pksi) bound to equilenin; d40n, y57(cl-y)

PDB Compounds: (B:) steroid delta-isomerase

SCOPe Domain Sequences for d5kp3b_:

Sequence; same for both SEQRES and ATOM records:

>d5kp3b_ d.17.4.3 (B:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]}
mnlptaqevqglmaryielvdvgdieaivqmyaddatvenpfgqppihgreqiaafxrqg
lgggkvracltgpvrashngcgampfrvemvwngqpcaldvidvmrfdehgriqtmqayw
sevnlsvr

Timeline for d5kp3b_:

• d5kp3b_ is new in SCOPe 2.06-stable
  
• d5kp3b_ appears in SCOPe 2.07
  
• d5kp3b_ appears in the current release, SCOPe 2.08