Lineage for d5k53b_ (5k53 B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703838Family a.25.1.6: PMT1231-like [158402] (2 proteins)
    PfamB PB016165
    automatically mapped to Pfam PF11266
  6. 2703849Protein automated matches [261918] (5 species)
    not a true protein
  7. 2703857Species Oscillatoria sp. [TaxId:1159] [322221] (1 PDB entry)
  8. 2703859Domain d5k53b_: 5k53 B: [322230]
    automated match to d4kvqa_
    complexed with fe, ste

Details for d5k53b_

PDB Entry: 5k53 (more details), 1.8 Å

PDB Description: crystal structures of aldehyde deformylating oxygenase from oscillatoria sp. knua011
PDB Compounds: (B:) aldehyde deformylating oxygenase

SCOPe Domain Sequences for d5k53b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k53b_ a.25.1.6 (B:) automated matches {Oscillatoria sp. [TaxId: 1159]}
idfqtetykdaysrinaiviegeqeahdnyltlaelladkkaelvglskmenrhmkgfqa
cgrnlkvtpdmafakqffselhknfqtaaaqgqivtclliqsliiecfaiaayniyipva
ddfarkitegvvkeeyshlnfgevwlqahfeeskaeleaanrqnlpiiwkllnavaddar
vlgmekdaliedfmiaygealgnigfnnrdimrmsaqgl

SCOPe Domain Coordinates for d5k53b_:

Click to download the PDB-style file with coordinates for d5k53b_.
(The format of our PDB-style files is described here.)

Timeline for d5k53b_: