Lineage for d5k3ja2 (5k3j A:279-474)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708627Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries)
  8. 2708660Domain d5k3ja2: 5k3j A:279-474 [322217]
    Other proteins in same PDB: d5k3ja1, d5k3ja4, d5k3jb1, d5k3jb4
    automated match to d1is2a1
    complexed with 6qa, atp, fad, mg

Details for d5k3ja2

PDB Entry: 5k3j (more details), 2.68 Å

PDB Description: crystals structure of acyl-coa oxidase-2 in caenorhabditis elegans bound with fad, ascaroside-coa, and atp
PDB Compounds: (A:) Acyl-coenzyme A oxidase

SCOPe Domain Sequences for d5k3ja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5k3ja2 a.29.3.0 (A:279-474) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
pphakigysgmvkirsqmameqglflahaltiaarysavrrqghlddkqvevkvldyqtq
qhrlfpslarayafiftgfetihlysqllkdvdmgntsgmadlhaltsglksvvahetge
gieqarmacgghgysmasyisvvygiaiggctyagenmvmllqlarylvksvelikagka
kklgpvasyladksde

SCOPe Domain Coordinates for d5k3ja2:

Click to download the PDB-style file with coordinates for d5k3ja2.
(The format of our PDB-style files is described here.)

Timeline for d5k3ja2: