![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
![]() | Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
![]() | Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
![]() | Protein automated matches [226935] (30 species) not a true protein |
![]() | Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries) |
![]() | Domain d5k3ja2: 5k3j A:279-474 [322217] Other proteins in same PDB: d5k3ja1, d5k3ja4, d5k3jb1, d5k3jb4 automated match to d1is2a1 complexed with 6qa, atp, fad, mg |
PDB Entry: 5k3j (more details), 2.68 Å
SCOPe Domain Sequences for d5k3ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3ja2 a.29.3.0 (A:279-474) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]} pphakigysgmvkirsqmameqglflahaltiaarysavrrqghlddkqvevkvldyqtq qhrlfpslarayafiftgfetihlysqllkdvdmgntsgmadlhaltsglksvvahetge gieqarmacgghgysmasyisvvygiaiggctyagenmvmllqlarylvksvelikagka kklgpvasyladksde
Timeline for d5k3ja2:
![]() Domains from other chains: (mouse over for more information) d5k3jb1, d5k3jb2, d5k3jb3, d5k3jb4 |