| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
| Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins) automatically mapped to Pfam PF01220 |
| Protein automated matches [190071] (6 species) not a true protein |
| Species Acinetobacter baumannii [TaxId:400667] [260436] (4 PDB entries) |
| Domain d5b6pj_: 5b6p J: [322211] automated match to d4rhca_ complexed with so4 |
PDB Entry: 5b6p (more details), 2 Å
SCOPe Domain Sequences for d5b6pj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b6pj_ c.23.13.1 (J:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
igvicglgakgysfaldyaiekiqp
Timeline for d5b6pj_: