Lineage for d5b6pj_ (5b6p J:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857821Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) (S)
  5. 2857822Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 proteins)
    automatically mapped to Pfam PF01220
  6. 2857936Protein automated matches [190071] (6 species)
    not a true protein
  7. 2857937Species Acinetobacter baumannii [TaxId:400667] [260436] (4 PDB entries)
  8. 2857959Domain d5b6pj_: 5b6p J: [322211]
    automated match to d4rhca_
    complexed with so4

Details for d5b6pj_

PDB Entry: 5b6p (more details), 2 Å

PDB Description: structure of the dodecameric type-ii dehydrogenate dehydratase from acinetobacter baumannii at 2.00 a resolution
PDB Compounds: (J:) 3-dehydroquinate dehydratase

SCOPe Domain Sequences for d5b6pj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5b6pj_ c.23.13.1 (J:) automated matches {Acinetobacter baumannii [TaxId: 400667]}
stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri
hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka
igvicglgakgysfaldyaiekiqp

SCOPe Domain Coordinates for d5b6pj_:

Click to download the PDB-style file with coordinates for d5b6pj_.
(The format of our PDB-style files is described here.)

Timeline for d5b6pj_: