| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.29: Bromodomain-like [47363] (15 superfamilies) 4 helices; bundle; minor mirror variant of up-and-down topology |
Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) ![]() multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel |
| Family a.29.3.0: automated matches [227204] (1 protein) not a true family |
| Protein automated matches [226935] (30 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [321815] (4 PDB entries) |
| Domain d5k3id3: 5k3i D:488-669 [322210] Other proteins in same PDB: d5k3ia1, d5k3ib1, d5k3ic1, d5k3id1, d5k3ie1, d5k3if1, d5k3ig1, d5k3ih1 automated match to d2ddha2 complexed with atp, fad, mg |
PDB Entry: 5k3i (more details), 2.68 Å
SCOPe Domain Sequences for d5k3id3:
Sequence; same for both SEQRES and ATOM records: (download)
>d5k3id3 a.29.3.0 (D:488-669) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
iteyiktfqhiakrqtlkaankffglmengekreiawnkssvelnrasrlhtrlfiveaf
arrvneigditikealsdllhlhvnyelldvatyaledgfmsstqldyvrdqlyfylqki
rpnavslldswefsdrelrsvlgrrdghvyenlfkwakesplnktdvlpsvdtylkpmme
ka
Timeline for d5k3id3: