Lineage for d1hona_ (1hon A:)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 121667Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 121668Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (16 families) (S)
  5. 122260Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 122261Protein Adenylosuccinate synthetase, PurA [52655] (4 species)
  7. 122265Species Escherichia coli [TaxId:562] [52656] (20 PDB entries)
  8. 122276Domain d1hona_: 1hon A: [32221]

Details for d1hona_

PDB Entry: 1hon (more details), 2.3 Å

PDB Description: structure of guanine nucleotide (gppcp) complex of adenylosuccinate synthetase from escherichia coli at ph 6.5 and 25 degree celsius

SCOP Domain Sequences for d1hona_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hona_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1hona_:

Click to download the PDB-style file with coordinates for d1hona_.
(The format of our PDB-style files is described here.)

Timeline for d1hona_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1honb_