Lineage for d1cg0a_ (1cg0 A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69969Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 69970Protein Adenylosuccinate synthetase, PurA [52655] (3 species)
  7. 69974Species Escherichia coli [TaxId:562] [52656] (20 PDB entries)
  8. 69982Domain d1cg0a_: 1cg0 A: [32220]

Details for d1cg0a_

PDB Entry: 1cg0 (more details), 2.5 Å

PDB Description: structure of adenylosuccinate synthetase from e. coli complexed with hadacidin, gdp, 6-phosphoryl-imp, and mg2+

SCOP Domain Sequences for d1cg0a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cg0a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1cg0a_:

Click to download the PDB-style file with coordinates for d1cg0a_.
(The format of our PDB-style files is described here.)

Timeline for d1cg0a_: