Lineage for d1hoob_ (1hoo B:)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 483669Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 483670Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (22 families) (S)
    division into families based on beta-sheet topologies
  5. 484706Family c.37.1.10: Nitrogenase iron protein-like [52652] (11 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 484707Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 484711Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)
  8. 484732Domain d1hoob_: 1hoo B: [32218]

Details for d1hoob_

PDB Entry: 1hoo (more details), 2.3 Å

PDB Description: structure of guanine nucleotide (gppcp) complex of adenylosuccinate synthetase from e. coli at ph 6.5 and 25 degrees celsius

SCOP Domain Sequences for d1hoob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hoob_ c.37.1.10 (B:) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1hoob_:

Click to download the PDB-style file with coordinates for d1hoob_.
(The format of our PDB-style files is described here.)

Timeline for d1hoob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hooa_