Lineage for d1hoob_ (1hoo B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69969Family c.37.1.10: Nitrogenase iron protein-like [52652] (8 proteins)
  6. 69970Protein Adenylosuccinate synthetase, PurA [52655] (3 species)
  7. 69974Species Escherichia coli [TaxId:562] [52656] (20 PDB entries)
  8. 69981Domain d1hoob_: 1hoo B: [32218]

Details for d1hoob_

PDB Entry: 1hoo (more details), 2.3 Å

PDB Description: structure of guanine nucleotide (gppcp) complex of adenylosuccinate synthetase from e. coli at ph 6.5 and 25 degrees celsius

SCOP Domain Sequences for d1hoob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1hoob_ c.37.1.10 (B:) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1hoob_:

Click to download the PDB-style file with coordinates for d1hoob_.
(The format of our PDB-style files is described here.)

Timeline for d1hoob_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1hooa_