| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Human rotavirus a [TaxId:10941] [187643] (15 PDB entries) |
| Domain d5gj6e_: 5gj6 E: [322175] automated match to d2dwra_ complexed with so4 |
PDB Entry: 5gj6 (more details), 2.39 Å
SCOPe Domain Sequences for d5gj6e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5gj6e_ b.29.1.0 (E:) automated matches {Human rotavirus a [TaxId: 10941]}
vldgpyqpvafkppndywilvnsnsngvvlegtnntdvwvaiisiepnvnsesrqyslfg
vnkqitvvntsnkwkfmemfrnnsnaefqhkrtltsstklvgilkhggrlwtyhgetpna
ttdysttsnlneisvttyaefyiiprsqeskcteyintgl
Timeline for d5gj6e_: