![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Listeria monocytogenes [TaxId:169963] [193523] (5 PDB entries) |
![]() | Domain d5f7va_: 5f7v A: [322168] automated match to d4qrza_ protein/RNA complex |
PDB Entry: 5f7v (more details), 1.4 Å
SCOPe Domain Sequences for d5f7va_:
Sequence, based on SEQRES records: (download)
>d5f7va_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]} dkteityyqfsapadgkaldemvkefekqnpdikvnvqtiafndyftklqtqiaggdapd afelnyetfmqyaekgvladltsyiekdkdfdpstlnkqaydafkydgkqygmvesfsnv vtiynkdlfdkagveyptadwtwkdeeaaakkltdaknkvwgtsqpvtmnefykvaaqng gsifnedltettinspenvealthltnevtdskvapspadlsgqlpedlfmngqiamlht giwlfdmfqdapfkwdvqveagntqkathffangigvskdsdkkeaafkfasfmsaneea akiridnnwelpatenkeilqpyldatppdnreavfeslqymvlppvvkdwnkisdytns efekvlngdstpekalknsedninktmgfk
>d5f7va_ c.94.1.0 (A:) automated matches {Listeria monocytogenes [TaxId: 169963]} dkteityyqfsapgkaldemvkefekqnpdikvnvqtiafndyftklqtqiaggdapdaf elnyetfmqyaekgvladltsyiekdkdfdpstlnkqaydafkydgkqygmvesfsnvvt iynkdlfdkagveyptadwtwkdeeaaakkltdaknkvwgtsqpvtmnefykvaaqnggs ifnedltettinspenvealthltnevtdskvapspadlsgqlpedlfmngqiamlhtgi wlfdmfqdapfkwdvqveagntqkathffangigvskdsdkkeaafkfasfmsaneeaak iridnnwelpatenkeilqpyldatppdnreavfeslqymvlppvvkdwnkisdytnsef ekvlngdstpekalknsedninktmgfk
Timeline for d5f7va_: