SCOPe 2.08: Domain d5ej3a_: 5ej3 A:

Lineage for d5ej3a_ (5ej3 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 proteins)

6. Protein automated matches [190135] (18 species)
   not a true protein

7. Species Streptomyces lividans [TaxId:1916] [322164] (1 PDB entry)

8. Domain d5ej3a_: 5ej3 A: [322165]
   automated match to d2vgda_

Details for d5ej3a_

PDB Entry: 5ej3, 1.31 Å

PDB Description: crystal structure of xlnb2

PDB Compounds: (A:) endo-1,4-beta-xylanase B

SCOPe Domain Sequences for d5ej3a_:

Sequence; same for both SEQRES and ATOM records:

>d5ej3a_ b.29.1.11 (A:) automated matches {Streptomyces lividans [TaxId: 1916]}
dtvvttnqegtnngyyysfwtdsqgtvsmnmgsggqystswrntgnfvagkgwanggrrt
vqysgsfnpsgnaylalygwtsnplveyyivdnwgtyrptgeykgtvtsdggtydiyktt
rvnkpsvegtrtfdqywsvrqskrtggtittgnhfdawaragmplgnfsyymimategyq
ssgsssinvgg

Timeline for d5ej3a_:

• d5ej3a_ first appeared in SCOPe 2.06
  
• d5ej3a_ appears in SCOPe 2.07