Lineage for d5dhwb2 (5dhw B:233-436)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2186669Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
    beta-alpha-beta(3); 2 layers: alpha/beta
  4. 2186670Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families) (S)
  5. 2186831Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
    duplication: consists of 2 similar domains with 2 repeats in each
    Similar to the Methylmalonyl-CoA epimerase dimer
  6. 2186869Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)
  7. 2186901Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (5 PDB entries)
    Uniprot P93836 33-428 ! Uniprot P93836 63-459
  8. 2186915Domain d5dhwb2: 5dhw B:233-436 [322161]
    automated match to d1sp9a2
    complexed with 5bq, fe

Details for d5dhwb2

PDB Entry: 5dhw (more details), 2.62 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with sulcotrione
PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5dhwb2:

Sequence, based on SEQRES records: (download)

>d5dhwb2 d.32.1.3 (B:233-436) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrks
qiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgd
vlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayq
sggcggfgkgnfselfksieeyek

Sequence, based on observed residues (ATOM records): (download)

>d5dhwb2 d.32.1.3 (B:233-436) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaefesglnsavlasndemvllpinepvhgrksqiqtylehne
gaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikec
eelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfselfk
sieeyek

SCOPe Domain Coordinates for d5dhwb2:

Click to download the PDB-style file with coordinates for d5dhwb2.
(The format of our PDB-style files is described here.)

Timeline for d5dhwb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5dhwb1