SCOPe 2.06: Domain d5dhwb2: 5dhw B:233-436

Lineage for d5dhwb2 (5dhw B:233-436)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.32: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54592] (1 superfamily)
   beta-alpha-beta(3); 2 layers: alpha/beta

4. Superfamily d.32.1: Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase [54593] (11 families)

5. Family d.32.1.3: Extradiol dioxygenases [54602] (5 proteins)
   duplication: consists of 2 similar domains with 2 repeats in each
   Similar to the Methylmalonyl-CoA epimerase dimer

6. Protein 4-hydroxyphenylpyruvate dioxygenase, HppD [54608] (6 species)

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [110877] (5 PDB entries)
   Uniprot P93836 33-428 ! Uniprot P93836 63-459

8. Domain d5dhwb2: 5dhw B:233-436 [322161]
   automated match to d1sp9a2
   complexed with 5bq, fe

Details for d5dhwb2

PDB Entry: 5dhw, 2.62 Å

PDB Description: crystal structure of arabidopsis thaliana hppd complexed with sulcotrione

PDB Compounds: (B:) 4-hydroxyphenylpyruvate dioxygenase

SCOPe Domain Sequences for d5dhwb2:

Sequence, based on SEQRES records:

>d5dhwb2 d.32.1.3 (B:233-436) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaeftaddvgtaesglnsavlasndemvllpinepvhgtkrks
qiqtylehnegaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgd
vlsddqikeceelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmkdeegkayq
sggcggfgkgnfselfksieeyek

Sequence, based on observed residues (ATOM records):

>d5dhwb2 d.32.1.3 (B:233-436) 4-hydroxyphenylpyruvate dioxygenase, HppD {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
elgpaltyvagftgfhqfaefesglnsavlasndemvllpinepvhgrksqiqtylehne
gaglqhlalmsedifrtlremrkrssiggfdfmpsppptyyqnlkkrvgdvlsddqikec
eelgilvdrddqgtllqiftkplgdrptifieiiqrvgcmmyqsggcggfgkgnfselfk
sieeyek

Timeline for d5dhwb2:

• d5dhwb2 is new in SCOPe 2.06-stable
  
• d5dhwb2 last appears in SCOPe 2.07