Lineage for d5crla_ (5crl A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696351Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
    core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different
  4. 2696352Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families) (S)
  5. 2696470Family a.6.1.0: automated matches [191604] (1 protein)
    not a true family
  6. 2696471Protein automated matches [191102] (6 species)
    not a true protein
  7. 2696494Species Pseudomonas aeruginosa [TaxId:287] [322153] (1 PDB entry)
  8. 2696495Domain d5crla_: 5crl A: [322158]
    automated match to d1q05b_
    complexed with hg

Details for d5crla_

PDB Entry: 5crl (more details), 2.8 Å

PDB Description: crystal structure of the transcription activator tn501 merr in complex with mercury (ii)
PDB Compounds: (A:) Mercuric resistance operon regulatory protein

SCOPe Domain Sequences for d5crla_:

Sequence, based on SEQRES records: (download)

>d5crla_ a.6.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
enltigvfakaagvnvetirfyqrkglllepdkpygsirrygeadvtrvrfvksaqrlgf
sldeiaellrledgthceeasslaehklkdvrekmadlarmeavlselvcacharrgnvs
cpliaslq

Sequence, based on observed residues (ATOM records): (download)

>d5crla_ a.6.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
enltigvfakaagvnvetirfyqrkglllrrygeadvtrvrfvksaqrlgfsldeiaell
rledgthceeasslaehklkdvrekmadlarmeavlselvcacharcpliaslq

SCOPe Domain Coordinates for d5crla_:

Click to download the PDB-style file with coordinates for d5crla_.
(The format of our PDB-style files is described here.)

Timeline for d5crla_: