SCOPe 2.08: Domain d5crla_: 5crl A:

Lineage for d5crla_ (5crl A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.0: automated matches [191604] (1 protein)
   not a true family

6. Protein automated matches [191102] (6 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [322153] (1 PDB entry)

8. Domain d5crla_: 5crl A: [322158]
   automated match to d1q05b_
   complexed with hg

Details for d5crla_

PDB Entry: 5crl, 2.8 Å

PDB Description: crystal structure of the transcription activator tn501 merr in complex with mercury (ii)

PDB Compounds: (A:) Mercuric resistance operon regulatory protein

SCOPe Domain Sequences for d5crla_:

Sequence, based on SEQRES records:

>d5crla_ a.6.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
enltigvfakaagvnvetirfyqrkglllepdkpygsirrygeadvtrvrfvksaqrlgf
sldeiaellrledgthceeasslaehklkdvrekmadlarmeavlselvcacharrgnvs
cpliaslq

Sequence, based on observed residues (ATOM records):

>d5crla_ a.6.1.0 (A:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
enltigvfakaagvnvetirfyqrkglllrrygeadvtrvrfvksaqrlgfsldeiaell
rledgthceeasslaehklkdvrekmadlarmeavlselvcacharcpliaslq

Timeline for d5crla_:

• d5crla_ first appeared in SCOPe 2.06
  
• d5crla_ appears in SCOPe 2.07