SCOPe 2.06: Domain d5crlb_: 5crl B:

Lineage for d5crlb_ (5crl B:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.6: Putative DNA-binding domain [46954] (1 superfamily)
   core: 3 helices; architecture is similar to that of the "winged helix" fold but topology is different

4. Superfamily a.6.1: Putative DNA-binding domain [46955] (8 families)

5. Family a.6.1.0: automated matches [191604] (1 protein)
   not a true family

6. Protein automated matches [191102] (5 species)
   not a true protein

7. Species Pseudomonas aeruginosa [TaxId:287] [322153] (1 PDB entry)

8. Domain d5crlb_: 5crl B: [322154]
   automated match to d1q05b_
   complexed with hg

Details for d5crlb_

PDB Entry: 5crl, 2.8 Å

PDB Description: crystal structure of the transcription activator tn501 merr in complex with mercury (ii)

PDB Compounds: (B:) Mercuric resistance operon regulatory protein

SCOPe Domain Sequences for d5crlb_:

Sequence, based on SEQRES records:

>d5crlb_ a.6.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
nltigvfakaagvnvetirfyqrkglllepdkpygsirrygeadvtrvrfvksaqrlgfs
ldeiaellrledgthceeasslaehklkdvrekmadlarmeavlselvcacharrgnvsc
pliaslqg

Sequence, based on observed residues (ATOM records):

>d5crlb_ a.6.1.0 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
nltigvfakaagvnvetirfyqrkglllrrygeadvtrvrfvksaqrlgfsldeiaellr
ledgthceeasslaehklkdvrekmadlarmeavlselvcacharrgnvscpliaslqg

Timeline for d5crlb_:

• d5crlb_ is new in SCOPe 2.06-stable
  
• d5crlb_ appears in SCOPe 2.07
  
• d5crlb_ appears in the current release, SCOPe 2.08