Lineage for d1qf4a_ (1qf4 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2446887Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2446888Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2449617Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 protein domains)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2449618Protein Adenylosuccinate synthetase, PurA [52655] (5 species)
    common fold is interrupted by an all-alpha subdomain, residues 100-200
  7. 2449619Species Escherichia coli [TaxId:562] [52656] (23 PDB entries)
  8. 2449621Domain d1qf4a_: 1qf4 A: [32215]
    complexed with gdp, mg, po4, rpd

Details for d1qf4a_

PDB Entry: 1qf4 (more details), 2.2 Å

PDB Description: design, synthesis, and x-ray crystal structure of an enzyme bound bisubstrate hybrid inhibitor of adenylosuccinate synthetase
PDB Compounds: (A:) protein (adenylosuccinate synthetase)

SCOPe Domain Sequences for d1qf4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf4a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOPe Domain Coordinates for d1qf4a_:

Click to download the PDB-style file with coordinates for d1qf4a_.
(The format of our PDB-style files is described here.)

Timeline for d1qf4a_: