![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
![]() | Protein Adenylosuccinate synthetase, PurA [52655] (5 species) common fold is interrupted by an all-alpha subdomain, residues 100-200 |
![]() | Species Escherichia coli [TaxId:562] [52656] (23 PDB entries) |
![]() | Domain d1qf4a_: 1qf4 A: [32215] complexed with gdp, mg, po4, rpd has additional subdomain(s) that are not in the common domain |
PDB Entry: 1qf4 (more details), 2.2 Å
SCOPe Domain Sequences for d1qf4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qf4a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli [TaxId: 562]} gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt etmilrdpfda
Timeline for d1qf4a_: