![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) ![]() |
![]() | Family c.23.13.1: Type II 3-dehydroquinate dehydratase [52305] (2 protein domains) automatically mapped to Pfam PF01220 |
![]() | Protein automated matches [190071] (5 species) not a true protein |
![]() | Species Acinetobacter baumannii [TaxId:400667] [260436] (4 PDB entries) |
![]() | Domain d5b6ph_: 5b6p H: [322147] automated match to d4rhca_ complexed with so4 |
PDB Entry: 5b6p (more details), 2 Å
SCOPe Domain Sequences for d5b6ph_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5b6ph_ c.23.13.1 (H:) automated matches {Acinetobacter baumannii [TaxId: 400667]} stilvihgpnlnllgkrepevyghltldninrqliaqaeqasitldtfqsnwegaivdri hqaqtegvkliiinpaalthtsvalrdallgvaipfievhlsnvhareafrhhsylsdka igvicglgakgysfaldyaiekiqp
Timeline for d5b6ph_: