Lineage for d5l8gq_ (5l8g Q:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312408Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2312409Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314636Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2314637Protein automated matches [190036] (44 species)
    not a true protein
  7. 2315361Species Rhodospirillum rubrum [TaxId:1085] [320959] (4 PDB entries)
  8. 2315456Domain d5l8gq_: 5l8g Q: [322144]
    Other proteins in same PDB: d5l8ga2, d5l8gb2, d5l8gc2, d5l8gd2, d5l8gf2, d5l8gg2, d5l8gh2, d5l8gi2, d5l8gj2, d5l8gk2, d5l8gl2, d5l8gn2, d5l8gp2, d5l8gt2, d5l8gu2
    automated match to d1zpyg_
    complexed with ca; mutant

Details for d5l8gq_

PDB Entry: 5l8g (more details), 2.97 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973 mutant h65a
PDB Compounds: (Q:) Uncharacterized protein

SCOPe Domain Sequences for d5l8gq_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l8gq_ a.25.1.0 (Q:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
amtlewlrrndakwaehlrtylftegpita

SCOPe Domain Coordinates for d5l8gq_:

Click to download the PDB-style file with coordinates for d5l8gq_.
(The format of our PDB-style files is described here.)

Timeline for d5l8gq_: