Lineage for d5l89o_ (5l89 O:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1989402Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1989403Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1991631Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 1991632Protein automated matches [190036] (39 species)
    not a true protein
  7. 1992348Species Rhodospirillum rubrum [TaxId:1085] [320959] (4 PDB entries)
  8. 1992415Domain d5l89o_: 5l89 O: [322127]
    Other proteins in same PDB: d5l89a2, d5l89d2, d5l89f2, d5l89g2, d5l89h2, d5l89l2, d5l89n2, d5l89p2, d5l89t2, d5l89u2
    automated match to d1zpyg_
    complexed with ca; mutant

Details for d5l89o_

PDB Entry: 5l89 (more details), 2.59 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a
PDB Compounds: (O:) Rru_A0973

SCOPe Domain Sequences for d5l89o_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l89o_ a.25.1.0 (O:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeekeha
amtlewlrrndakwaehlrtylftegpita

SCOPe Domain Coordinates for d5l89o_:

Click to download the PDB-style file with coordinates for d5l89o_.
(The format of our PDB-style files is described here.)

Timeline for d5l89o_: