Lineage for d5l89x_ (5l89 X:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2700837Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2700838Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2703895Family a.25.1.0: automated matches [191307] (1 protein)
    not a true family
  6. 2703896Protein automated matches [190036] (60 species)
    not a true protein
  7. 2704883Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries)
  8. 2704985Domain d5l89x_: 5l89 X: [322126]
    Other proteins in same PDB: d5l89a2, d5l89d2, d5l89f2, d5l89g2, d5l89h2, d5l89l2, d5l89n2, d5l89p2, d5l89t2, d5l89u2
    automated match to d1zpyg_
    complexed with ca; mutant

Details for d5l89x_

PDB Entry: 5l89 (more details), 2.59 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973 mutant e32a
PDB Compounds: (X:) Rru_A0973

SCOPe Domain Sequences for d5l89x_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l89x_ a.25.1.0 (X:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
theplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeekehaa
mtlewlrrndakwaehlrtylftegpit

SCOPe Domain Coordinates for d5l89x_:

Click to download the PDB-style file with coordinates for d5l89x_.
(The format of our PDB-style files is described here.)

Timeline for d5l89x_: