Lineage for d1qf5a_ (1qf5 A:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23416Protein Adenylosuccinate synthetase, PurA [52655] (3 species)
  7. 23420Species Escherichia coli [TaxId:562] [52656] (20 PDB entries)
  8. 23421Domain d1qf5a_: 1qf5 A: [32212]

Details for d1qf5a_

PDB Entry: 1qf5 (more details), 2 Å

PDB Description: design, synthesis, and x-ray crystal structure of an enzyme bound bisubstrate hybrid inhibitor of adenylosuccinate synthetase

SCOP Domain Sequences for d1qf5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qf5a_ c.37.1.10 (A:) Adenylosuccinate synthetase, PurA {Escherichia coli}
gnnvvvlgtqwgdegkgkivdllterakyvvryqgghnaghtlvingektvlhlipsgil
renvtsiigngvvlspaalmkemkeledrgipvrerlllseacplildyhvaldnareka
rgakaigttgrgigpayedkvarrglrvgdlfdketfaeklkevmeyhnfqlvnyykaea
vdyqkvlddtmavadiltsmvvdvsdlldqarqrgdfvmfegaqgtlldidhgtypyvts
snttaggvatgsglgpryvdyvlgilkaystrvgagpfptelfdetgeflckqgnefgat
tgrrrrtgwldtvavrravqlnslsgfcltkldvldglkevklcvayrmpdgrevtttpl
aaddwkgvepiyetmpgwsestfgvkdrsglpqaalnyikrieeltgvpidiistgpdrt
etmilrdpfda

SCOP Domain Coordinates for d1qf5a_:

Click to download the PDB-style file with coordinates for d1qf5a_.
(The format of our PDB-style files is described here.)

Timeline for d1qf5a_: