Class b: All beta proteins [48724] (177 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold |
Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 proteins) Pfam PF13640; PubMed 16782814 |
Protein automated matches [254532] (2 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [255179] (25 PDB entries) |
Domain d5lata_: 5lat A: [322108] automated match to d3ouja_ protein/DNA complex; complexed with bct, gol, mn, un9 |
PDB Entry: 5lat (more details), 1.9 Å
SCOPe Domain Sequences for d5lata_:
Sequence, based on SEQRES records: (download)
>d5lata_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgng tgyvrhvdnrngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw sdrrnphevqpayatryaitvwyfdaderarakvkyltgekgvr
>d5lata_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykingrtkamvacypgng tgyvrhvdnrngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw sdrrnphevqpayatryaitvwyfdaderarakvkylkgvr
Timeline for d5lata_: