![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
![]() | Protein automated matches [190036] (60 species) not a true protein |
![]() | Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries) |
![]() | Domain d5l89e_: 5l89 E: [322101] Other proteins in same PDB: d5l89a2, d5l89d2, d5l89f2, d5l89g2, d5l89h2, d5l89l2, d5l89n2, d5l89p2, d5l89t2, d5l89u2 automated match to d1zpyg_ complexed with ca; mutant |
PDB Entry: 5l89 (more details), 2.59 Å
SCOPe Domain Sequences for d5l89e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l89e_ a.25.1.0 (E:) automated matches {Rhodospirillum rubrum [TaxId: 1085]} stheplevlkeetvnrhraivsvmealeavdwydqrvdastdpeltailahnrdeekeha amtlewlrrndakwaehlrtylftegpita
Timeline for d5l89e_:
![]() Domains from other chains: (mouse over for more information) d5l89a1, d5l89a2, d5l89b_, d5l89c_, d5l89d1, d5l89d2, d5l89f1, d5l89f2, d5l89g1, d5l89g2, d5l89h1, d5l89h2, d5l89i_, d5l89j_, d5l89k_, d5l89l1, d5l89l2, d5l89m_, d5l89n1, d5l89n2, d5l89o_, d5l89p1, d5l89p2, d5l89q_, d5l89r_, d5l89s_, d5l89t1, d5l89t2, d5l89u1, d5l89u2, d5l89v_, d5l89w_, d5l89x_, d5l89y_, d5l89z_ |