| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries) |
| Domain d5l8gz_: 5l8g Z: [322098] Other proteins in same PDB: d5l8ga2, d5l8gb2, d5l8gc2, d5l8gd2, d5l8gf2, d5l8gg2, d5l8gh2, d5l8gi2, d5l8gj2, d5l8gk2, d5l8gl2, d5l8gn2, d5l8gp2, d5l8gt2, d5l8gu2 automated match to d1zpyg_ complexed with ca; mutant |
PDB Entry: 5l8g (more details), 2.97 Å
SCOPe Domain Sequences for d5l8gz_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8gz_ a.25.1.0 (Z:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaaa
mtlewlrrndakwaehlrtylftegpi
Timeline for d5l8gz_:
View in 3DDomains from other chains: (mouse over for more information) d5l8ga1, d5l8ga2, d5l8gb1, d5l8gb2, d5l8gc1, d5l8gc2, d5l8gd1, d5l8gd2, d5l8ge_, d5l8gf1, d5l8gf2, d5l8gg1, d5l8gg2, d5l8gh1, d5l8gh2, d5l8gi1, d5l8gi2, d5l8gj1, d5l8gj2, d5l8gk1, d5l8gk2, d5l8gl1, d5l8gl2, d5l8gm_, d5l8gn1, d5l8gn2, d5l8go_, d5l8gp1, d5l8gp2, d5l8gq_, d5l8gr_, d5l8gs_, d5l8gt1, d5l8gt2, d5l8gu1, d5l8gu2, d5l8gv_, d5l8gw_, d5l8gx_, d5l8gy_ |