SCOPe 2.08: Domain d5sw7a_: 5sw7 A:

Lineage for d5sw7a_ (5sw7 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46487] (291 PDB entries)
   Uniprot P69905 P01922 P01934 P01935

8. Domain d5sw7a_: 5sw7 A: [322090]
   Other proteins in same PDB: d5sw7b_
   automated match to d1irda_
   complexed with cmo, hem, po4; mutant

Details for d5sw7a_

PDB Entry: 5sw7, 1.85 Å

PDB Description: structure of the human hemoglobin mutant hb providence (a-gly-c:v1m; b,d:v1m,k82d; ferrous, carbonmonoxy bound)

PDB Compounds: (A:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d5sw7a_:

Sequence; same for both SEQRES and ATOM records:

>d5sw7a_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Human (Homo sapiens) [TaxId: 9606]}
mlspadktnvkaawgkvgahageygaealermflsfpttktyfphfdlshgsaqvkghgk
kvadaltnavahvddmpnalsalsdlhahklrvdpvnfkllshcllvtlaahlpaeftpa
vhasldkflasvstvltskyrg

Timeline for d5sw7a_:

• d5sw7a_ first appeared in SCOPe 2.06
  
• d5sw7a_ appears in SCOPe 2.07