Lineage for d5ldga_ (5ldg A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2106799Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2106800Protein automated matches [190069] (239 species)
    not a true protein
  7. 2108097Species Mentha piperita [TaxId:34256] [321972] (5 PDB entries)
  8. 2108098Domain d5ldga_: 5ldg A: [322077]
    automated match to d3o26a_
    complexed with it9, nap

Details for d5ldga_

PDB Entry: 5ldg (more details), 1.3 Å

PDB Description: isopiperitenone reductase from mentha piperita in complex with isopiperitenone and nadp
PDB Compounds: (A:) (-)-isopiperitenone reductase

SCOPe Domain Sequences for d5ldga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ldga_ c.2.1.0 (A:) automated matches {Mentha piperita [TaxId: 34256]}
qryalvtgankgigfeicrqlaekgiiviltsrnekrglearqkllkelnvsenrlvfhq
ldvtdlasvaavavfikskfgkldilvnnagvsgvemvgdvsvfneyieadfkalqalea
gakeeppfkpkangemiekfegakdcvvtnyygpkrltqalipllqlspsprivnvsssf
gsllllwnewakgvlgdedrlteervdevvevflkdikegkleesqwpphfaaervskaa
lnaytkiaakkypsfrinaicpgyaktditfhagplsvaeaaqvpvklallpdggpsgcf
fprdkalaly

SCOPe Domain Coordinates for d5ldga_:

Click to download the PDB-style file with coordinates for d5ldga_.
(The format of our PDB-style files is described here.)

Timeline for d5ldga_: