![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) ![]() |
![]() | Family d.15.4.0: automated matches [191632] (1 protein) not a true family |
![]() | Protein automated matches [191164] (24 species) not a true protein |
![]() | Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [322058] (1 PDB entry) |
![]() | Domain d4zhoa1: 4zho A:2-96 [322071] Other proteins in same PDB: d4zhoa2, d4zhob2 automated match to d1pfda_ complexed with cl, fes |
PDB Entry: 4zho (more details), 2.34 Å
SCOPe Domain Sequences for d4zhoa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zhoa1 d.15.4.0 (A:2-96) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} atykvkfitpegelevecdddvyvldaaeeagidlpyscragscsscagkvvsgsvdqsd qsflddeqigegfvltcaayptsdvtiethkeeai
Timeline for d4zhoa1: