Lineage for d1dafa_ (1daf A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2869013Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. 2869108Protein Dethiobiotin synthetase [52653] (1 species)
  7. 2869109Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)
  8. 2869118Domain d1dafa_: 1daf A: [32207]
    complexed with adp, ca, dsd

Details for d1dafa_

PDB Entry: 1daf (more details), 1.7 Å

PDB Description: dethiobiotin synthetase complexed with 7-(carboxyamino)-8-amino-nonanoic acid, adp, and calcium
PDB Compounds: (A:) dethiobiotin synthetase

SCOPe Domain Sequences for d1dafa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dafa_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

SCOPe Domain Coordinates for d1dafa_:

Click to download the PDB-style file with coordinates for d1dafa_.
(The format of our PDB-style files is described here.)

Timeline for d1dafa_: