SCOPe 2.08: Domain d5l8gk1: 5l8g K:7-96

Lineage for d5l8gk1 (5l8g K:7-96)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.0: automated matches [191307] (1 protein)
   not a true family

6. Protein automated matches [190036] (60 species)
   not a true protein

7. Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries)

8. Domain d5l8gk1: 5l8g K:7-96 [322062]
   Other proteins in same PDB: d5l8ga2, d5l8gb2, d5l8gc2, d5l8gd2, d5l8gf2, d5l8gg2, d5l8gh2, d5l8gi2, d5l8gj2, d5l8gk2, d5l8gl2, d5l8gn2, d5l8gp2, d5l8gt2, d5l8gu2
   automated match to d1zpyg_
   complexed with ca; mutant

Details for d5l8gk1

PDB Entry: 5l8g, 2.97 Å

PDB Description: crystal structure of rhodospirillum rubrum rru_a0973 mutant h65a

PDB Compounds: (K:) Uncharacterized protein

SCOPe Domain Sequences for d5l8gk1:

Sequence; same for both SEQRES and ATOM records:

>d5l8gk1 a.25.1.0 (K:7-96) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
stheplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeekeaa
amtlewlrrndakwaehlrtylftegpita

Timeline for d5l8gk1:

• d5l8gk1 first appeared in SCOPe 2.06
  
• d5l8gk1 appears in SCOPe 2.07