Lineage for d4zhob1 (4zho B:2-96)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2501110Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2503073Superfamily d.15.4: 2Fe-2S ferredoxin-like [54292] (3 families) (S)
  5. 2503459Family d.15.4.0: automated matches [191632] (1 protein)
    not a true family
  6. 2503460Protein automated matches [191164] (22 species)
    not a true protein
  7. 2503549Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [322058] (1 PDB entry)
  8. 2503551Domain d4zhob1: 4zho B:2-96 [322059]
    Other proteins in same PDB: d4zhoa2, d4zhob2
    automated match to d1pfda_
    complexed with cl, fes

Details for d4zhob1

PDB Entry: 4zho (more details), 2.34 Å

PDB Description: the crystal structure of arabidopsis ferredoxin 2 with 2fe-2s cluster
PDB Compounds: (B:) Ferredoxin-2, chloroplastic

SCOPe Domain Sequences for d4zhob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zhob1 d.15.4.0 (B:2-96) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
atykvkfitpegelevecdddvyvldaaeeagidlpyscragscsscagkvvsgsvdqsd
qsflddeqigegfvltcaayptsdvtiethkeeai

SCOPe Domain Coordinates for d4zhob1:

Click to download the PDB-style file with coordinates for d4zhob1.
(The format of our PDB-style files is described here.)

Timeline for d4zhob1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4zhob2