SCOPe 2.08: Domain d5l0ca_: 5l0c A:

Lineage for d5l0ca_ (5l0c A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families)

5. Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
   possible duplication: contains several domains of this fold
   The listed PDB entries contain different large fragments but not the whole proteins

6. Protein Vinculin [47224] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
   Uniprot P18206 1-257

8. Domain d5l0ca_: 5l0c A: [322052]
   automated match to d3vf0a_
   complexed with pio, po4

Details for d5l0ca_

PDB Entry: 5l0c, 3.1 Å

PDB Description: human metavinculin (residues 959-1134) in complex with pip2

PDB Compounds: (A:) vinculin

SCOPe Domain Sequences for d5l0ca_:

Sequence; same for both SEQRES and ATOM records:

>d5l0ca_ a.24.9.1 (A:) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
nqpvnqpilaaaqslhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtn
isdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpwyq

Timeline for d5l0ca_:

• d5l0ca_ first appeared in SCOPe 2.06
  
• d5l0ca_ appears in SCOPe 2.07