Lineage for d5sxqa1 (5sxq A:36-443)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333593Family a.93.1.3: Catalase-peroxidase KatG [74753] (1 protein)
    duplication: tandem repeat of two CCP-like domains
  6. 2333594Protein Catalase-peroxidase KatG [74754] (6 species)
    only the N-terminal CCP-like domain binds heme
  7. 2333607Species Burkholderia pseudomallei [TaxId:320372] [321159] (45 PDB entries)
  8. 2333780Domain d5sxqa1: 5sxq A:36-443 [322050]
    automated match to d3n3oa1
    complexed with cl, hem, mpd, na, niz, oxy, po4

Details for d5sxqa1

PDB Entry: 5sxq (more details), 2.1 Å

PDB Description: crystal structure of b. pseudomallei katg with isonicotinic acid hydrazide bound
PDB Compounds: (A:) Catalase-peroxidase

SCOPe Domain Sequences for d5sxqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5sxqa1 a.93.1.3 (A:36-443) Catalase-peroxidase KatG {Burkholderia pseudomallei [TaxId: 320372]}
gtsnrdwwpnqldlsilhrhsslsdpmgkdfnyaqafekldlaavkrdlhalmttsqdww
padfghygglfirmawhsagtyrtadgrggagegqqrfaplnswpdnanldkarrllwpi
kqkygraiswadlliltgnvalesmgfktfgfaggradtwepedvywgsekiwlelsggp
nsrysgdrqlenplaavqmgliyvnpegpdgnpdpvaaardirdtfarmamndeetvali
agghtfgkthgagpasnvgaepeaagieaqglgwksayrtgkgadaitsglevtwtttpt
qwshnffenlfgyeweltkspagahqwvakgadavipdafdpskkhrptmlttdlslrfd
payekisrrfhenpeqfadafarawfklthrdmgprarylgpevpaev

SCOPe Domain Coordinates for d5sxqa1:

Click to download the PDB-style file with coordinates for d5sxqa1.
(The format of our PDB-style files is described here.)

Timeline for d5sxqa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d5sxqa2