Lineage for d1dad__ (1dad -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23415Family c.37.1.10: Nitrogenase iron protein-like [52652] (7 proteins)
  6. 23453Protein Dethiobiotin synthetase [52653] (1 species)
  7. 23454Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)
  8. 23460Domain d1dad__: 1dad - [32204]

Details for d1dad__

PDB Entry: 1dad (more details), 1.6 Å

PDB Description: dethiobiotin synthetase complexed with adp

SCOP Domain Sequences for d1dad__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dad__ c.37.1.10 (-) Dethiobiotin synthetase {Escherichia coli}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

SCOP Domain Coordinates for d1dad__:

Click to download the PDB-style file with coordinates for d1dad__.
(The format of our PDB-style files is described here.)

Timeline for d1dad__: