Lineage for d1dada_ (1dad A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
    core: parallel beta-sheet of 7 strands; order 3241567
  6. Protein Dethiobiotin synthetase [52653] (1 species)
  7. Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)
  8. Domain d1dada_: 1dad A: [32204]
    complexed with adp

Details for d1dada_

PDB Entry: 1dad (more details), 1.6 Å

PDB Description: dethiobiotin synthetase complexed with adp
PDB Compounds: (A:) dethiobiotin synthetase

SCOPe Domain Sequences for d1dada_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dada_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

SCOPe Domain Coordinates for d1dada_ are not available.

Timeline for d1dada_: