SCOPe 2.06: Domain d1daka_: 1dak A:

Lineage for d1daka_ (1dak A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins)
   core: parallel beta-sheet of 7 strands; order 3241567

6. Protein Dethiobiotin synthetase [52653] (1 species)

7. Species Escherichia coli [TaxId:562] [52654] (13 PDB entries)

8. Domain d1daka_: 1dak A: [32203]
   complexed with adp, dpu, mg, po4

Details for d1daka_

PDB Entry: 1dak, 1.6 Å

PDB Description: dethiobiotin synthetase from escherichia coli, complex reaction intermediate adp and mixed anhydride

PDB Compounds: (A:) dethiobiotin synthetase

SCOPe Domain Sequences for d1daka_:

Sequence; same for both SEQRES and ATOM records:

>d1daka_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]}
skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr
nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw
ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp
gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall

Timeline for d1daka_:

• d1daka_ first appeared (with stable ids) in SCOP 1.55
  
• d1daka_ appears in SCOPe 2.05
  
• d1daka_ appears in SCOPe 2.07
  
• d1daka_ appears in the current release, SCOPe 2.08