Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.10: Nitrogenase iron protein-like [52652] (16 proteins) core: parallel beta-sheet of 7 strands; order 3241567 |
Protein Dethiobiotin synthetase [52653] (1 species) |
Species Escherichia coli [TaxId:562] [52654] (13 PDB entries) |
Domain d1daka_: 1dak A: [32203] complexed with adp, dpu, mg, po4 |
PDB Entry: 1dak (more details), 1.6 Å
SCOPe Domain Sequences for d1daka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1daka_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} skryfvtgtdtevgktvascallqaakaagyrtagykpvasgsektpeglrnsdalalqr nsslqldyatvnpytfaeptsphiisaqegrpieslvmsaglraleqqadwvlvegaggw ftplsdtftfadwvtqeqlpvilvvgvklgcinhamltaqviqhagltlagwvandvtpp gkrhaeymttltrmipapllgeipwlaenpenaatgkyinlall
Timeline for d1daka_: