Lineage for d5l0db_ (5l0d B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311272Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2311768Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2311769Family a.24.9.1: alpha-catenin/vinculin [47221] (3 protein domains)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2311785Protein Vinculin [47224] (2 species)
  7. 2311799Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
    Uniprot P18206 1-257
  8. 2311821Domain d5l0db_: 5l0d B: [322021]
    automated match to d3vf0a_
    complexed with pio

Details for d5l0db_

PDB Entry: 5l0d (more details), 2.75 Å

PDB Description: human metavinculin(residues 959-1130) in complex with pip2
PDB Compounds: (B:) vinculin

SCOPe Domain Sequences for d5l0db_:

Sequence, based on SEQRES records: (download)

>d5l0db_ a.24.9.1 (B:) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
qpvnqpilaaaqslhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqca
kdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtni
sdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrkt

Sequence, based on observed residues (ATOM records): (download)

>d5l0db_ a.24.9.1 (B:) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
qpvnqpilaaaqslhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqca
kdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtni
sdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdgftlrwvrkt

SCOPe Domain Coordinates for d5l0db_:

Click to download the PDB-style file with coordinates for d5l0db_.
(The format of our PDB-style files is described here.)

Timeline for d5l0db_: