SCOPe 2.08: Domain d5sw7b_: 5sw7 B:

Lineage for d5sw7b_ (5sw7 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (26 species)

7. Species Human (Homo sapiens) [TaxId:9606] [46501] (289 PDB entries)
   Uniprot P68871

8. Domain d5sw7b_: 5sw7 B: [322014]
   Other proteins in same PDB: d5sw7a_
   automated match to d1dxub_
   complexed with cmo, hem, po4; mutant

Details for d5sw7b_

PDB Entry: 5sw7, 1.85 Å

PDB Description: structure of the human hemoglobin mutant hb providence (a-gly-c:v1m; b,d:v1m,k82d; ferrous, carbonmonoxy bound)

PDB Compounds: (B:) Hemoglobin subunit beta

SCOPe Domain Sequences for d5sw7b_:

Sequence; same for both SEQRES and ATOM records:

>d5sw7b_ a.1.1.2 (B:) Hemoglobin, beta-chain {Human (Homo sapiens) [TaxId: 9606]}
mhltpeeksavtalwgkvnvdevggealgrllvvypwtqrffesfgdlstpdavmgnpkv
kahgkkvlgafsdglahldnldgtfatlselhcdklhvdpenfrllgnvlvcvlahhfgk
eftppvqaayqkvvagvanalahkyh

Timeline for d5sw7b_:

• d5sw7b_ first appeared in SCOPe 2.06
  
• d5sw7b_ appears in SCOPe 2.07