Lineage for d5l0cc_ (5l0c C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700096Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2700097Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2700113Protein Vinculin [47224] (2 species)
  7. 2700127Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
    Uniprot P18206 1-257
  8. 2700161Domain d5l0cc_: 5l0c C: [322005]
    automated match to d3vf0a_
    complexed with pio, po4

Details for d5l0cc_

PDB Entry: 5l0c (more details), 3.1 Å

PDB Description: human metavinculin (residues 959-1134) in complex with pip2
PDB Compounds: (C:) vinculin

SCOPe Domain Sequences for d5l0cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l0cc_ a.24.9.1 (C:) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
nqpvnqpilaaaqslhreatkwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtn
isdeeseqatemlvhnaqnlmqsvketvreaeaasikirtdagftlrwvrktpwy

SCOPe Domain Coordinates for d5l0cc_:

Click to download the PDB-style file with coordinates for d5l0cc_.
(The format of our PDB-style files is described here.)

Timeline for d5l0cc_: