Lineage for d5l0fb_ (5l0f B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2312794Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2313443Superfamily a.24.9: alpha-catenin/vinculin-like [47220] (2 families) (S)
  5. 2313444Family a.24.9.1: alpha-catenin/vinculin [47221] (3 proteins)
    possible duplication: contains several domains of this fold
    The listed PDB entries contain different large fragments but not the whole proteins
  6. 2313460Protein Vinculin [47224] (2 species)
  7. 2313474Species Human (Homo sapiens) [TaxId:9606] [101111] (16 PDB entries)
    Uniprot P18206 1-257
  8. 2313500Domain d5l0fb_: 5l0f B: [322002]
    automated match to d3vf0a_
    complexed with gol; mutant

Details for d5l0fb_

PDB Entry: 5l0f (more details), 2.76 Å

PDB Description: human metavinculin quadruple mutant (residues 959-1134)
PDB Compounds: (B:) vinculin

SCOPe Domain Sequences for d5l0fb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5l0fb_ a.24.9.1 (B:) Vinculin {Human (Homo sapiens) [TaxId: 9606]}
nqpvnqpilaaaqslhqeatqwsskgndiiaaakrmallmaemsrlvrggsgtkraliqc
akdiakasdevtrlakevakqctdkrirtnllqvceriptistqlkilstvkatmlgrtn
isdeeseqatemlvhnaqnlmqsvketvqeaeaasikirtdagftlrwvqktpwyq

SCOPe Domain Coordinates for d5l0fb_:

Click to download the PDB-style file with coordinates for d5l0fb_.
(The format of our PDB-style files is described here.)

Timeline for d5l0fb_: