Lineage for d5ljia_ (5lji A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2439108Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2439628Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2439629Protein automated matches [190158] (24 species)
    not a true protein
  7. 2439755Species Pneumococcus (Streptococcus pneumoniae) [TaxId:1313] [322000] (1 PDB entry)
  8. 2439756Domain d5ljia_: 5lji A: [322001]
    automated match to d4heqa_
    complexed with ca, fmn

Details for d5ljia_

PDB Entry: 5lji (more details), 2.07 Å

PDB Description: streptococcus pneumonia tigr4 flavodoxin: structural and biophysical characterization of a novel drug target
PDB Compounds: (A:) flavodoxin

SCOPe Domain Sequences for d5ljia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ljia_ c.23.5.0 (A:) automated matches {Pneumococcus (Streptococcus pneumoniae) [TaxId: 1313]}
alakivfasmtgnteeiadivadklrdlgldvdvdecttvdasdfleadiaivatytygd
gelpdemmdfyedladlnlngkiygvvgsgdtfydefckavddfdrvfvstgaekgsecv
kvdlsaeeedierleqfaeelaakv

SCOPe Domain Coordinates for d5ljia_:

Click to download the PDB-style file with coordinates for d5ljia_.
(The format of our PDB-style files is described here.)

Timeline for d5ljia_: