Lineage for d5e5ub2 (5e5u B:223-316)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2754035Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2754036Protein automated matches [190740] (31 species)
    not a true protein
  7. 2759478Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)
  8. 2760057Domain d5e5ub2: 5e5u B:223-316 [321994]
    Other proteins in same PDB: d5e5ua_, d5e5ub3, d5e5uc_, d5e5ud3
    automated match to d3s97d2
    complexed with 1ps, acy, fmt, mli, mlt

Details for d5e5ub2

PDB Entry: 5e5u (more details), 2 Å

PDB Description: crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn6
PDB Compounds: (B:) Contactin-6

SCOPe Domain Sequences for d5e5ub2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5e5ub2 b.1.1.0 (B:223-316) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
geyepkievrfpetiqaakdssiklecfalgnpvpdiswkrldgspmpgkikysksqail
eipkfqqedegfyeciagnlrgrnlakgqlifya

SCOPe Domain Coordinates for d5e5ub2:

Click to download the PDB-style file with coordinates for d5e5ub2.
(The format of our PDB-style files is described here.)

Timeline for d5e5ub2: