Lineage for d5lbea_ (5lbe A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2403751Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 2404605Superfamily b.82.2: Clavaminate synthase-like [51197] (16 families) (S)
    Iron and ketoglutarate-dependent enzymes; elaborated version of this common fold
  5. 2405353Family b.82.2.15: proly-4-hydroxylase (P4H, PHD) like [254173] (3 protein domains)
    Pfam PF13640; PubMed 16782814
  6. 2405361Protein automated matches [254532] (2 species)
    not a true protein
  7. 2405369Species Human (Homo sapiens) [TaxId:9606] [255179] (25 PDB entries)
  8. 2405381Domain d5lbea_: 5lbe A: [321990]
    automated match to d3ouja_
    protein/DNA complex; complexed with bct, mn, un9

Details for d5lbea_

PDB Entry: 5lbe (more details), 1.75 Å

PDB Description: hif prolyl hydroxylase 2 (phd2/egln1) g294e variant in complex with mn(ii) and n-[(1-chloro-4-hydroxyisoquinolin-3-yl)carbonyl]glycine (iox3/fg2216)
PDB Compounds: (A:) Egl nine homolog 1

SCOPe Domain Sequences for d5lbea_:

Sequence, based on SEQRES records: (download)

>d5lbea_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqksds
skdirgdkitwiegkepgcetigllmssmddlirhcngklgsykinertkamvacypgng
tgyvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffw
sdrrnphevqpayatryaitvwyfdaderarakvkyltgekgvrve

Sequence, based on observed residues (ATOM records): (download)

>d5lbea_ b.82.2.15 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lpalklaleyivpcmnkhgicvvddflgketgqqigdevralhdtgkftdgqlvsqdssk
dirgdkitwiegkepgcetigllmssmddlirhcngklgsykinertkamvacypgngtg
yvrhvdnpngdgrcvtciyylnkdwdakvsggilrifpegkaqfadiepkfdrllffwsd
rrnphevqpayatryaitvwyfdaderarakvkylgvrve

SCOPe Domain Coordinates for d5lbea_:

Click to download the PDB-style file with coordinates for d5lbea_.
(The format of our PDB-style files is described here.)

Timeline for d5lbea_: