SCOPe 2.08: Domain d5e5rd1: 5e5r D:124-222

Lineage for d5e5rd1 (5e5r D:124-222)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5e5rd1: 5e5r D:124-222 [321982]
   Other proteins in same PDB: d5e5ra_, d5e5rc_
   automated match to d3s97c1
   complexed with fmt, mli

Details for d5e5rd1

PDB Entry: 5e5r, 2.6 Å

PDB Description: crystal structure of the complex between carbonic anhydrase-like domain of ptprg and immunoglobulin domains 2-3 of cntn3

PDB Compounds: (D:) Contactin-3

SCOPe Domain Sequences for d5e5rd1:

Sequence, based on SEQRES records:

>d5e5rd1 b.1.1.0 (D:124-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fktrmrstvsvregqgvvllcgppphsgelsyawvfneypsfveedsrrfvsqetghlyi
akvepsdvgnytcvvtstvtntrvlgsptplvlrsdgvm

Sequence, based on observed residues (ATOM records):

>d5e5rd1 b.1.1.0 (D:124-222) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
fktrmrstvsvregqgvvllcgpppsgelsyawvfneypsfveedsrrfvsqetghlyia
kvepsdvgnytcvvtstvtntrvlgsptplvlrsdgvm

Timeline for d5e5rd1:

• d5e5rd1 first appeared in SCOPe 2.06
  
• d5e5rd1 appears in SCOPe 2.07