Lineage for d3kar__ (3kar -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 22942Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 22943Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (14 families) (S)
  5. 23359Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 23367Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
  7. 23368Species Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId:4932] [52651] (1 PDB entry)
  8. 23369Domain d3kar__: 3kar - [32198]

Details for d3kar__

PDB Entry: 3kar (more details), 2.3 Å

PDB Description: the motor domain of kinesin-like protein kar3, a saccharomyces cerevisiae kinesin-related protein

SCOP Domain Sequences for d3kar__:

Sequence, based on SEQRES records: (download)

>d3kar__ c.37.1.9 (-) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar}
gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
klktkgwdykvncefieiynenivdllrsdnnnkedtsiglkheirhdqetktttitnvt
sckleseemveiilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnl
vdlagserinvsqvvgdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyll
qysltgdsktlmfvnispssshinetlnslrfaskvns

Sequence, based on observed residues (ATOM records): (download)

>d3kar__ c.37.1.9 (-) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar}
gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
klktkgwdykvncefieiynenivdllrslkheirhdqetktttitnvtsckleseemve
iilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnlvdlagserinv
sdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyllqysltgdsktlmfvn
ispssshinetlnslrfaskvns

SCOP Domain Coordinates for d3kar__:

Click to download the PDB-style file with coordinates for d3kar__.
(The format of our PDB-style files is described here.)

Timeline for d3kar__: