Lineage for d3kara_ (3kar A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2111568Family c.37.1.9: Motor proteins [52641] (5 protein domains)
  6. 2111634Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
    contains coiled-coil neck
  7. 2111635Species Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId:4932] [52651] (5 PDB entries)
    kinesin-like protein
  8. 2111639Domain d3kara_: 3kar A: [32198]
    complexed with adp, mg

Details for d3kara_

PDB Entry: 3kar (more details), 2.3 Å

PDB Description: the motor domain of kinesin-like protein kar3, a saccharomyces cerevisiae kinesin-related protein
PDB Compounds: (A:) kinesin-like protein kar3

SCOPe Domain Sequences for d3kara_:

Sequence, based on SEQRES records: (download)

>d3kara_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]}
gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
klktkgwdykvncefieiynenivdllrsdnnnkedtsiglkheirhdqetktttitnvt
sckleseemveiilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnl
vdlagserinvsqvvgdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyll
qysltgdsktlmfvnispssshinetlnslrfaskvns

Sequence, based on observed residues (ATOM records): (download)

>d3kara_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]}
gnirvycrirpalknlensdtslinvnefddnsgvqsmevtkiqntaqvhefkfdkifdq
qdtnvdvfkevgqlvqssldgynvcifaygqtgsgktftmlnpgdgiipstishifnwin
klktkgwdykvncefieiynenivdllrslkheirhdqetktttitnvtsckleseemve
iilkkanklrstastasnehssrshsifiihlsgsnaktgahsygtlnlvdlagserinv
sdrlretqninkslsclgdvihalgqpdstkrhipfrnskltyllqysltgdsktlmfvn
ispssshinetlnslrfaskvns

SCOPe Domain Coordinates for d3kara_:

Click to download the PDB-style file with coordinates for d3kara_.
(The format of our PDB-style files is described here.)

Timeline for d3kara_: