Lineage for d5l53a_ (5l53 A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2426096Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2426097Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2430344Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2430345Protein automated matches [190069] (243 species)
    not a true protein
  7. 2431647Species Mentha piperita [TaxId:34256] [321972] (5 PDB entries)
  8. 2431651Domain d5l53a_: 5l53 A: [321973]
    automated match to d3o26a_
    complexed with nap

Details for d5l53a_

PDB Entry: 5l53 (more details), 2.24 Å

PDB Description: menthone neomenthol reductase from mentha piperita in complex with nadp
PDB Compounds: (A:) (-)-menthone:(+)-neomenthol reductase

SCOPe Domain Sequences for d5l53a_:

Sequence, based on SEQRES records: (download)

>d5l53a_ c.2.1.0 (A:) automated matches {Mentha piperita [TaxId: 34256]}
atkryavvtgankgigfeickqlaskgitvilasrdekrgiearerlikelgsefgdyvv
sqqldvadpasvaalvdfiktkfgsldilvnnaglngtymegdasvlndyveaefktfqs
gaaktepyhpkatgrlvetvehakecietnyygskrvtealipllqqsdsprivnvsstl
sslvfqtnewakgvfsseeglteekleevlaeflkdfidgkqqekqwpphfsaykvskaa
lnaytriiakkypsfrinavcpgytktdlsyghgqftdaeaaeapvklallpqggpsgcf
ffrdeafc

Sequence, based on observed residues (ATOM records): (download)

>d5l53a_ c.2.1.0 (A:) automated matches {Mentha piperita [TaxId: 34256]}
atkryavvtgankgigfeickqlaskgitvilasrdekrgiearerlikelgsefgdyvv
sqqldvadpasvaalvdfiktkfgsldilvnnaglngtymegdasvlndyveaefktfqs
gaaktepyhpkatgrlvetvehakecietnyygskrvtealipllqqsdsprivnvsstl
sslvfqtnewakgvfsseeglteekleevlaeflkdfidgkqqekqwpphfsaykvskaa
lnaytriiakkypsfrinavcptdaeaaeapvklallpqggpsgcfffrdeafc

SCOPe Domain Coordinates for d5l53a_:

Click to download the PDB-style file with coordinates for d5l53a_.
(The format of our PDB-style files is described here.)

Timeline for d5l53a_: