Lineage for d5ktia1 (5kti A:64-208)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002291Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries)
  8. 3002294Domain d5ktia1: 5kti A:64-208 [321969]
    Other proteins in same PDB: d5ktia2, d5ktia3
    automated match to d3whda_
    complexed with 6x6, ca, pge

Details for d5ktia1

PDB Entry: 5kti (more details), 1.8 Å

PDB Description: structure of cow mincle complexed with kmj1
PDB Compounds: (A:) mincle protein

SCOPe Domain Sequences for d5ktia1:

Sequence, based on SEQRES records: (download)

>d5ktia1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elscyndgsgsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeq
eflyytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatird
ssnprqnwndvpcffnmfrvcempe

Sequence, based on observed residues (ATOM records): (download)

>d5ktia1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]}
elscynsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqefly
ytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnp
rqnwndvpcffnmfrvcempe

SCOPe Domain Coordinates for d5ktia1:

Click to download the PDB-style file with coordinates for d5ktia1.
(The format of our PDB-style files is described here.)

Timeline for d5ktia1: