Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (21 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [227618] (6 PDB entries) |
Domain d5ktia1: 5kti A:64-208 [321969] Other proteins in same PDB: d5ktia2, d5ktia3 automated match to d3whda_ complexed with 6x6, ca, pge |
PDB Entry: 5kti (more details), 1.8 Å
SCOPe Domain Sequences for d5ktia1:
Sequence, based on SEQRES records: (download)
>d5ktia1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]} elscyndgsgsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeq eflyytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatird ssnprqnwndvpcffnmfrvcempe
>d5ktia1 d.169.1.0 (A:64-208) automated matches {Cow (Bos taurus) [TaxId: 9913]} elscynsvknccplkwfhfqsscylfspdtmswraslkncssmgahlvvintqeeqefly ytkprkkefyigltdqvtegqwqwvdgtpftkslsfwdagepnnlvtvedcatirdssnp rqnwndvpcffnmfrvcempe
Timeline for d5ktia1: