Lineage for d1cz7b_ (1cz7 B:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 69448Fold c.37: P-loop containing nucleotide triphosphate hydrolases [52539] (1 superfamily)
  4. 69449Superfamily c.37.1: P-loop containing nucleotide triphosphate hydrolases [52540] (15 families) (S)
  5. 69902Family c.37.1.9: Motor proteins [52641] (3 proteins)
  6. 69916Protein Kinesin motor Ncd (non-claret disjunctional) [52649] (2 species)
  7. 69924Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [52650] (2 PDB entries)
  8. 69927Domain d1cz7b_: 1cz7 B: [32195]

Details for d1cz7b_

PDB Entry: 1cz7 (more details), 2.9 Å

PDB Description: the crystal structure of a minus-end directed microtubule motor protein ncd reveals variable dimer conformations

SCOP Domain Sequences for d1cz7b_:

Sequence, based on SEQRES records: (download)

>d1cz7b_ c.37.1.9 (B:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster)}
eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
eligrhaekqeisvgsinlvdlagsespktstrmtetkninrslseltnvilallqkqdh
ipyrnsklthllmpslggnsktlmfinvspfqdcfqesvkslrfaasvn

Sequence, based on observed residues (ATOM records): (download)

>d1cz7b_ c.37.1.9 (B:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster)}
eletckeqlfqsnmerkelhntvmdlrgnirvfcrirppleseenrmcctwtyhdestve
lqsidaqakskmgqqifsfdqvfhplssqsdifemvspliqsaldgynicifaygqtgsg
ktytmdgvpesvgviprtvdllfdsirgyrnlgweyeikatfleiynevlydllsneqkd
meirmaknnkndiyvsniteetvldpnhlrhlmhtakmnratastagnerssrshavtkl
eligrhaekqeisvgsinlvdlagsesinrslseltnvilallqkqdhipyrnsklthll
mpslggnsktlmfinvspfqdcfqesvkslrfaasvn

SCOP Domain Coordinates for d1cz7b_:

Click to download the PDB-style file with coordinates for d1cz7b_.
(The format of our PDB-style files is described here.)

Timeline for d1cz7b_: