| Class a: All alpha proteins [46456] (290 folds) |
| Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
| Family a.25.1.0: automated matches [191307] (1 protein) not a true family |
| Protein automated matches [190036] (60 species) not a true protein |
| Species Rhodospirillum rubrum [TaxId:1085] [320959] (5 PDB entries) |
| Domain d5l8bk_: 5l8b K: [321941] Other proteins in same PDB: d5l8be2, d5l8bi2, d5l8bj2, d5l8bo2, d5l8bq2, d5l8br2, d5l8bs2, d5l8bu2 automated match to d1zpyg_ complexed with ca; mutant |
PDB Entry: 5l8b (more details), 2.21 Å
SCOPe Domain Sequences for d5l8bk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5l8bk_ a.25.1.0 (K:) automated matches {Rhodospirillum rubrum [TaxId: 1085]}
theplevlkeetvnrhraivsvmeeleavdwydqrvdastdpeltailahnrdeakehaa
mtlewlrrndakwaehlrtylftegpit
Timeline for d5l8bk_:
View in 3DDomains from other chains: (mouse over for more information) d5l8ba_, d5l8bb_, d5l8bc_, d5l8bd_, d5l8be1, d5l8be2, d5l8bf_, d5l8bg_, d5l8bh_, d5l8bi1, d5l8bi2, d5l8bj1, d5l8bj2, d5l8bl_, d5l8bm_, d5l8bn_, d5l8bo1, d5l8bo2, d5l8bp_, d5l8bq1, d5l8bq2, d5l8br1, d5l8br2, d5l8bs1, d5l8bs2, d5l8bt_, d5l8bu1, d5l8bu2, d5l8bv_, d5l8bw_, d5l8bx_, d5l8by_, d5l8bz_ |