SCOPe 2.06: Domain d5dg5a_: 5dg5 A:

Lineage for d5dg5a_ (5dg5 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Hepatocyte growth factor receptor, c-MET [103300] (1 species)
   PTK group; HGFR subfamily; membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [103301] (52 PDB entries)

8. Domain d5dg5a_: 5dg5 A: [321932]
   automated match to d4eeva_
   complexed with 5b4

Details for d5dg5a_

PDB Entry: 5dg5, 2.6 Å

PDB Description: crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor c-met in complex with altiratinib analog dp- 4157

PDB Compounds: (A:) Hepatocyte growth factor receptor

SCOPe Domain Sequences for d5dg5a_:

Sequence; same for both SEQRES and ATOM records:

>d5dg5a_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]}
tvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkihcav
kslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfi
rnethnptvkdligfglqvakgmkylaskkfvhrdlaarncmldekftvkvadfglardm
ydkeyysvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypdvnt
fditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig

Timeline for d5dg5a_:

• d5dg5a_ is new in SCOPe 2.06-stable
  
• d5dg5a_ appears in SCOPe 2.07
  
• d5dg5a_ appears in the current release, SCOPe 2.08